PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00217.1.g00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 377aa    MW: 42734.9 Da    PI: 8.0261
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00217.1.g00180.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-17141188148
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                     +g+WT++Ed++lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
  Zmw_sc00217.1.g00180.1.am.mkhc 141 KGPWTEQEDLQLVCTVRLFGERRWDFIAKVSGLNRTGKSCRLRWVNYL 188
                                     79********************************************97 PP

2Myb_DNA-binding54.92e-17194239148
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                     rgr+T+ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  Zmw_sc00217.1.g00180.1.am.mkhc 194 RGRMTPHEERLILELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 239
                                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.259136188IPR017930Myb domain
SMARTSM007171.9E-15140190IPR001005SANT/Myb domain
SuperFamilySSF466895.62E-29140235IPR009057Homeodomain-like
PfamPF002493.4E-16141188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-19142195IPR009057Homeodomain-like
CDDcd001672.73E-11143188No hitNo description
PROSITE profilePS5129425.994189243IPR017930Myb domain
SMARTSM007171.1E-16193241IPR001005SANT/Myb domain
PfamPF002494.2E-15194238IPR001005SANT/Myb domain
CDDcd001676.60E-12196239No hitNo description
Gene3DG3DSA:1.10.10.608.9E-24196242IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MDSFFMIGGP LIFDPSPLFR SRRGASCQLT VDNDDAWKGL PAGGRKGSLR RPRRYKDRSV  60
AGTHSHTDDF KDNATMEFWF TSFPSPSPSS SSSLSHTGVH HGYTPKTGSN RHAEEEEQED  120
RLLADTRVYV AMVTVREETR KGPWTEQEDL QLVCTVRLFG ERRWDFIAKV SGLNRTGKSC  180
RLRWVNYLHP GLKRGRMTPH EERLILELHA RWGNRWSRIA RRLPGRTDNE IKNYWRTHMR  240
KKAQERKRNM SPSSSSSSLT YQSCYPDTPP IIGAEGQELH GGSSCITSIL KGTPPDMEVY  300
PLDQFWLEVD EPEAPHPVTG FDGLKLQDLP CSSSSSLPGP LPPSAGDYYY PEACWKMDDE  360
IKMAQQFGYS EGAGPCF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-281412424104C-Myb DNA-Binding Domain
1mse_C2e-281412424104C-Myb DNA-Binding Domain
1gv2_A3e-281382421104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14854LRRPRRY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962720.11e-140PREDICTED: myb-related protein MYBAS2-like
SwissprotQ4JL761e-123MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLK3Z9831e-140K3Z983_SETIT; Uncharacterized protein
STRINGSi023104m1e-139(Setaria italica)
STRINGSb08g018580.11e-139(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169